PDB entry 1a6b

View 1a6b on RCSB PDB site
Description: nmr structure of the complex between the zinc finger protein ncp10 of moloney murine leukemia virus and a sequence of the psi-packaging domain of hiv-1, 20 structures
Class: Viral protein/DNA
Keywords: NUCLEOCAPSID PROTEIN, INTERCALATION, NUCLEIC ACID, RETROVIRUS, ZINC FINGER, Viral protein/DNA COMPLEX
Deposited on 1998-02-23, released 1999-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*cp*gp*cp*c)-3')
  • Chain 'B':
    Compound: zinc finger protein ncp10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a6bb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a6bB (B:)
    gerrrsqldrdqcayckekghwakdcpkkprgprgprpqt