PDB entry 1a68

View 1a68 on RCSB PDB site
Description: crystal structure of the tetramerization domain of the shaker potassium channel
Deposited on 1998-03-06, released 1998-06-10
The last revision prior to the SCOP 1.61 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1a68__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a68_ (-)
    ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
    qsggrlrrpvnvpldvfseeikfyelg