PDB entry 1a68

View 1a68 on RCSB PDB site
Description: crystal structure of the tetramerization domain of the shaker potassium channel
Class: potassium channels
Keywords: potassium channels, tetramerization domain, x-ray structure, aplysia kv1.1
Deposited on 1998-03-06, released 1998-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel kv1.1
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a68a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1a68A (A:)
mervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyf
yqsggrlrrpvnvpldvfseeikfyelgenafery

    Sequence, based on observed residues (ATOM records): (download) 
    >1a68A (A:)
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvnvpldvfseeikfyelg