PDB entry 1a67

View 1a67 on RCSB PDB site
Description: chicken egg white cystatin wildtype, nmr, 16 structures
Deposited on 1998-03-06, released 1998-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1a67__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a67_ (-)
    gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
    ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq