PDB entry 1a67

View 1a67 on RCSB PDB site
Description: chicken egg white cystatin wildtype, nmr, 16 structures
Class: proteinase inhibitor
Keywords: proteinase inhibitor, thiol proteinase, steffins, kininogens
Deposited on 1998-03-06, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cystatin
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01038 (0-107)
  Domains in SCOPe 2.08: d1a67a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a67A (A:)
  gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
  ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq