PDB entry 1a66

View 1a66 on RCSB PDB site
Description: solution nmr structure of the core nfatc1/DNA complex, 18 structures
Class: transcription/DNA
Keywords: nfatc1/DNA, rel, nfat/DNA, arre2, nfat, nfatc1, nfatc, nfat2, nmr, binary complex, transcription factor, enhanceosome, il-2, complex, binary, transcription/DNA complex
Deposited on 1998-03-06, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: core nfatc1
    Species: Homo sapiens [TaxId:9606]
    Gene: NFATC1(416-591)
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95644 (0-177)
      • engineered (0-1)
      • engineered (27)
    Domains in SCOPe 2.07: d1a66a_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*ap*gp*gp*ap*ap*ap*ap*tp*tp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*ap*tp*tp*tp*tp*cp*cp*tp*cp*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a66A (A:)
    mkdwqlpshsgpyelrievqpkshhraryetegsrgavkasagghpivqlhgyleneplm
    lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
    agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.