PDB entry 1a65

View 1a65 on RCSB PDB site
Description: type-2 cu-depleted laccase from coprinus cinereus
Deposited on 1998-03-05, released 1999-03-30
The last revision prior to the SCOP 1.63 freeze date was dated 1999-04-16, with a file datestamp of 1999-04-15.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.16
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a65A (A:)
    qivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp
    tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl
    rgpmviyddndphaalydeddentiitladwyhipapsiqgaaqpdatlingkgryvggp
    aaelsivnveqgkkyrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftg
    qrysfvldanqpvdnywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnp
    aqlneadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqims
    gaqsandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvn
    pvkrdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannpp
    vewaqlceiyddlppeatsiqtvv