PDB entry 1a64

View 1a64 on RCSB PDB site
Description: engineering a misfolded form of rat cd2
Deposited on 1998-03-05, released 1998-05-27
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2306
AEROSPACI score: -1.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a64a_
  • Chain 'B':
    Domains in SCOP 1.57: d1a64b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a64A (A:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a64B (B:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile