PDB entry 1a64

View 1a64 on RCSB PDB site
Description: engineering a misfolded form of rat cd2
Class: domain swapping
Keywords: domain swapping, hinge loop, oligomer evolution
Deposited on 1998-03-05, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a64a_
  • Chain 'B':
    Compound: cd2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a64b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a64A (A:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangd
    lkiknltrddsgtynvtvystngtrildkaldlrile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a64A (A:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a64B (B:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangd
    lkiknltrddsgtynvtvystngtrildkaldlrile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a64B (B:)
    gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
    knltrddsgtynvtvystngtrildkaldlrile