PDB entry 1a63

View 1a63 on RCSB PDB site
Description: the nmr structure of the RNA binding domain of e.coli rho factor suggests possible RNA-protein interactions, 10 structures
Class: transcription termination
Keywords: transcription termination, termination, RNA binding domain, transcription regulation, ob fold
Deposited on 1998-03-05, released 1998-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rho
  Species: Escherichia coli BL21(DE3) [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03002 (0-129)
  Domains in SCOPe 2.04: d1a63a1, d1a63a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a63A (A:)
  mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
  gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
  fdkpenarnk