PDB entry 1a63

View 1a63 on RCSB PDB site
Description: the nmr structure of the RNA binding domain of e.coli rho factor suggests possible RNA-protein interactions, 10 structures
Class: transcription termination
Keywords: transcription termination, termination, RNA binding domain, transcription regulation, ob fold
Deposited on 1998-03-05, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho
    Species: Escherichia coli [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a63a1, d1a63a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a63A (A:)
    mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksgedifgdgvleilqd
    gfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegeryfallkvnevn
    fdkpenarnk