PDB entry 1a5z

View 1a5z on RCSB PDB site
Description: lactate dehydrogenase from thermotoga maritima (tmldh)
Class: oxidoreductase
Keywords: oxidoreductase, glycolysis, hyperthermophiles, thermotoga maritima, protein stability
Deposited on 1998-02-18, released 1999-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16115 (0-End)
      • conflict (195)
    Domains in SCOPe 2.07: d1a5za1, d1a5za2
  • Heterogens: FBP, CD, OXM, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a5zA (A:)
    mkigivglgrvgsstafallmkgfaremvlidvdkkraegdaldlihgtpftrraniyag
    dyadlkgsdvvivaagvpqkpgetrlqllgrnarvmkeiarnvskyapdsivivvtnpvd
    vltyfflkesgmdprkvfgsgtvldtarlrtliaqhcgfsprsvhvyvigehgdsevpvw
    sgamiggiplqnmcqvcqkcdskilenfaektkraayeiierkgathyaialavadives
    iffdekrvltlsvyledylgvkdlcisvpvtlgkhgverilelnlneeeleafrksasil
    knaineitaeenkhqntsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5zA (A:)
    mkigivglgrvgsstafallmkgfaremvlidvdkkraegdaldlihgtpftrraniyag
    dyadlkgsdvvivaagvpqkpgetrlqllgrnarvmkeiarnvskyapdsivivvtnpvd
    vltyfflkesgmdprkvfgsgtvldtarlrtliaqhcgfsprsvhvyvigehgdsevpvw
    sgamiggiplqnmcqvcqkcdskilenfaektkraayeiierkgathyaialavadives
    iffdekrvltlsvyledylgvkdlcisvpvtlgkhgverilelnlneeeleafrksasil
    knaineitaeen