PDB entry 1a5w

View 1a5w on RCSB PDB site
Description: asv integrase core domain with hiv-1 integrase inhibitor y3
Class: hydrolase
Keywords: hydrolase, endonuclease, hiv-1 integrase inhibitor
Deposited on 1998-02-18, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Rous sarcoma virus (strain Schmidt-Ruppin) [TaxId:11889]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • variant (49)
      • variant (114)
    Domains in SCOPe 2.07: d1a5wa_
  • Heterogens: Y3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a5wA (A:)
    prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiav
    lgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvla
    egdgfmkriptskqgellakamyalnhfergentktnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5wA (A:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf