PDB entry 1a5u

View 1a5u on RCSB PDB site
Description: pyruvate kinase complex with bis mg-atp-na-oxalate
Deposited on 1998-02-18, released 1999-03-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uA (A:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uB (B:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uC (C:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uD (D:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uE (E:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uF (F:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uG (G:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5uH (H:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp