PDB entry 1a5t

View 1a5t on RCSB PDB site
Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii
Deposited on 1998-02-18, released 1998-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1a5t_ (-)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5t_ (-)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrvtnvdvpglvaelanhlspsrlqailgdvchireqlmsvtgi
    nrellitdlllriehylqpgvvlp