PDB entry 1a5t

View 1a5t on RCSB PDB site
Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli DNA polymerase III
Class: zinc finger
Keywords: zinc finger, DNA replication
Deposited on 1998-02-18, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta prime
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: HOLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5ta1, d1a5ta2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a5tA (A:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrhhgaaqvtnvdvpglvaelanhlspsrlqailgdvchireql
    msvtginrellitdlllriehylqpgvvlpvphl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5tA (A:)
    mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
    hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
    tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
    tmsqdallaalrlsagspgaalalfqgdnwqaretlcqalaysvpsgdwysllaalnheq
    aparlhwlatllmdalkrvtnvdvpglvaelanhlspsrlqailgdvchireqlmsvtgi
    nrellitdlllriehylqpgvvlp