PDB entry 1a5s

View 1a5s on RCSB PDB site
Description: crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate and l-ser bound as amino acrylate to the beta site
Deposited on 1998-02-17, released 1999-03-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a5sa_
  • Chain 'B':
    Domains in SCOP 1.55: d1a5sb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a5sA (A:)
    eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
    ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
    gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
    vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
    eknlaspkqmlaelrsfvsamkaasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5sA (A:)
    eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
    ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
    gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
    vtgaenlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspk
    qmlaelrsfvsamkaasr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5sB (B:)
    tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
    qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
    sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
    tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
    dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
    gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
    reqpekeqllvvnlsgrgdkdiftvhd