PDB entry 1a5r

View 1a5r on RCSB PDB site
Description: structure determination of the small ubiquitin-related modifier sumo-1, nmr, 10 structures
Class: targeting protein
Keywords: sumo-1, post-translational protein modification, ubiquitin-like proteins, targeting protein
Deposited on 1998-02-18, released 1998-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 1998-10-14, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sumo-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1a5ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5rA (A:)
    gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
    mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv