PDB entry 1a5r

View 1a5r on RCSB PDB site
Description: structure determination of the small ubiquitin-related modifier sumo- 1, nmr, 10 structures
Deposited on 1998-02-18, released 1998-10-14
The last revision prior to the SCOP 1.69 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1a5r__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5r_ (-)
    gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
    mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv