PDB entry 1a5q

View 1a5q on RCSB PDB site
Description: p93a variant of bovine pancreatic ribonuclease a
Class: hydrolase
Keywords: hydrolase (nucleic acid, RNA)
Deposited on 1998-02-17, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered (92)
  Domains in SCOPe 2.08: d1a5qa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a5qA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskyancaykttqankhiivacegnpyvpvhf
  dasv