PDB entry 1a5o

View 1a5o on RCSB PDB site
Description: k217c variant of klebsiella aerogenes urease, chemically rescued by formate and nickel
Class: hydrolase
Keywords: hydrolase (urea amido), mutant, nickel metalloenzyme, hydrolase
Deposited on 1998-02-17, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease (gamma subunit)
    Species: Klebsiella aerogenes [TaxId:28451]
    Gene: UREA, UREB, UREC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5oa_
  • Chain 'B':
    Compound: urease (beta subunit)
    Species: Klebsiella aerogenes [TaxId:28451]
    Gene: UREA, UREB, UREC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5ob_
  • Chain 'C':
    Compound: urease (alpha subunit)
    Species: Klebsiella aerogenes [TaxId:28451]
    Gene: UREA, UREB, UREC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18314 (0-565)
      • engineered (215)
    Domains in SCOPe 2.07: d1a5oc1, d1a5oc2
  • Heterogens: NI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5oA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5oB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5oC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglcihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf