PDB entry 1a5j

View 1a5j on RCSB PDB site
Description: chicken b-myb DNA binding domain, repeat 2 and repeat3, nmr, 32 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, protooncogene product
Deposited on 1998-02-16, released 1998-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: b-myb
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1a5ja1, d1a5ja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5jA (A:)
    gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnpevkks
    swteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt