PDB entry 1a5j

View 1a5j on RCSB PDB site
Description: chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures
Deposited on 1998-02-16, released 1998-07-01
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-01, with a file datestamp of 1998-07-01.
Experiment type: NMR32
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1a5j_1, d1a5j_2

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a5j_ (-)
  gipdlvkgpwtkeedqkvielvkkygtkqwtliakhlkgrlgkqcrerwhnhlnpevkks
  swteeedriifeahkvlgnrwaeiakllpgrtdnavknhwnstikrkvdt