PDB entry 1a5i

View 1a5i on RCSB PDB site
Description: catalytic domain of vampire bat (desmodus rotundus) saliva plasminogen activator in complex with egr-cmk (glu-gly-arg chloromethyl ketone)
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, fibrinolytic enzymes, plasminogen activators, hydrolase-hydrolase inhibitor complex
Deposited on 1998-02-17, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plasminogen activator
  Species: Desmodus rotundus [TaxId:9430]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98119 (1-264)
  Domains in SCOPe 2.08: d1a5ia_
• Heterogens: 0GJ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a5iA (A:)
  tcglrkykepqlhstgglftditshpwqaaifaqnrrssgerflcggilisscwvltaah
  cfqesylpdqlkvvlgrtyrvkpgeeeqtfkvkkyivhkefdddtynndiallqlksdsp
  qcaqesdsvraiclpeanlqlpdwtecelsgygkhkssspfyseqlkeghvrlypssrca
  pkflfnktvtnnmlcagdtrsgeiypnvhdacqgdsggplvcmndnhmtllgiiswgvgc
  gekdvpgvytkvtnylgwirdnmhl