PDB entry 1a5h

View 1a5h on RCSB PDB site
Description: catalytic domain of human two-chain tissue plasminogen activator complex of a bis-benzamidine
Class: hydrolase
Keywords: trypsin like serine protease, fibrinolytic enzyme, hydrolase
Deposited on 1998-02-17, released 1999-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.178
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5h.1
  • Chain 'B':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5h.2
  • Chain 'C':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5h.1
  • Chain 'D':
    Compound: tissue plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5h.2
  • Heterogens: BBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5hA (A:)
    ikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaahcfqerfpphhltv
    ilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdssrcaqessvvrtvc
    lppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrctsqhllnrtvtdnm
    lcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgcgqkdvpgvytkvt
    nyldwirdnmrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5hB (B:)
    ikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaahcfqerfpphhltv
    ilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdssrcaqessvvrtvc
    lppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrctsqhllnrtvtdnm
    lcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgcgqkdvpgvytkvt
    nyldwirdnmrp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5hC (C:)
    tcglrqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5hD (D:)
    tcglrqy