PDB entry 1a5f

View 1a5f on RCSB PDB site
Description: fab fragment of a monoclonal anti-e-selectin antibody
Deposited on 1998-02-16, released 1999-04-20
The last revision prior to the SCOP 1.69 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.195
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a5fH (H:)
    evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
    dptfkgkatitaddssntaylqmssltsedtavyycarvglsywyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvsvptstetvtcnvahapsstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5fH (H:)
    evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
    dptfkgkatitaddssntaylqmssltsedtavyycarvyamdywgqgtsvtvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvsvptstetvtcnvahapsstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5fL (L:)
    divmtqspssltvttgekvtmtckssqsllnsgaqknyltwyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec