PDB entry 1a5e

View 1a5e on RCSB PDB site
Description: solution nmr structure of tumor suppressor p16ink4a, 18 structures
Class: anti-oncogene
Keywords: cell cycle, anti-oncogene, repeat, ank repeat
Deposited on 1998-02-13, released 1999-08-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor suppressor p16ink4a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42771 (0-155)
  Domains in SCOPe 2.08: d1a5ea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a5eA (A:)
  mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
  ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
  lghrdvarylraaaggtrgsnharidaaegpsdipd