PDB entry 1a5e

View 1a5e on RCSB PDB site
Description: solution nmr structure of tumor suppressor p16ink4a, 18 structures
Class: anti-oncogene
Keywords: cell cycle, anti-oncogene, repeat, ank repeat
Deposited on 1998-02-13, released 1999-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor suppressor p16ink4a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5eA (A:)
    mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
    ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
    lghrdvarylraaaggtrgsnharidaaegpsdipd