PDB entry 1a5d

View 1a5d on RCSB PDB site
Description: gammae crystallin from rat lens
Class: eye lens protein
Keywords: eye lens protein
Deposited on 1998-02-12, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gammae crystallin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a5da1, d1a5da2
  • Chain 'B':
    Compound: gammae crystallin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1a5db1, d1a5db2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5dA (A:)
    gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
    dypdyqqwmgfsdsvrscrliphssshririyeredyrgqmveitddcphlqdrfhfsdf
    hsfhvmegywvlyempnyrgrqyllrpgeyrryhdwgamnarvgslrrimdfy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a5dB (B:)
    gkitfyedrgfqgrhyecstdhsnlqpyfsrcnsvrvdsgcwmlyeqpnftgcqyflrrg
    dypdyqqwmgfsdsvrscrliphssshririyeredyrgqmveitddcphlqdrfhfsdf
    hsfhvmegywvlyempnyrgrqyllrpgeyrryhdwgamnarvgslrrimdfy