PDB entry 1a5b

View 1a5b on RCSB PDB site
Description: cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alpha d60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49
Class: lyase
Keywords: carbon-oxygen lyase, mutation at position 60 (asp --> asn) in the a-subunit, true substrate indole-3-glycerol phosphate in the a-subunit, lyase
Deposited on 1998-02-12, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase (alpha chain)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPA/TRPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00929 (0-267)
      • engineered (59)
    Domains in SCOPe 2.07: d1a5ba_
  • Chain 'B':
    Compound: tryptophan synthase (beta chain)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: TRPA/TRPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a5bb_
  • Heterogens: K, IGP, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a5bA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplan
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5bA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplan
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytylliek
    lkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfv
    samkaasra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a5bB (B:)
    mttllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptalt
    kcqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasa
    lasallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgs
    yetahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigm
    fadfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysi
    sagldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalk
    mmreqpekeqllvvnlsgrgdkdiftvhdilkargli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a5bB (B:)
    tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
    qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
    sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
    tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
    dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
    gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
    reqpekeqllvvnlsgrgdkdiftvhdil