PDB entry 1a59

View 1a59 on RCSB PDB site
Description: cold-active citrate synthase
Class: cold-activity
Keywords: cold-activity
Deposited on 1998-02-20, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.184
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Antarctic bacterium DS2-3R [TaxId:56673]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a59a_
  • Heterogens: COA, CIT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a59A (A:)
    teptihkglagvtadvtaiskvnsdtnsllyrgypvqelaakcsfeqvayllwnselpnd
    selkafvnfershrkldenvkgaidllstachpmdvartavsvlganharaqdsspeanl
    ekamsllatfpsvvaydqrrrrgeeliepredldysanflwmtfgeeaapevveafnvsm
    ilyaehsfnastftarvitstladlhsavtgaigalkgplhgganeavmhtfeeigirkd
    esldeaatrskawmvdalaqkkkvmgfghrvykngdsrvptmksaldamikhydrpemlg
    lyngleaameeakqikpnldypagptynlmgfdtemftplfiaaritgwtahimeqvadn
    alirplseyngpeqrqvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a59A (A:)
    eptihkglagvtadvtaiskvnsdtnsllyrgypvqelaakcsfeqvayllwnselpnds
    elkafvnfershrkldenvkgaidllstachpmdvartavsvlganharaqdsspeanle
    kamsllatfpsvvaydqrrrrgeeliepredldysanflwmtfgeeaapevveafnvsmi
    lyaehsfnastftarvitstladlhsavtgaigalkgplhgganeavmhtfeeigirkde
    sldeaatrskawmvdalaqkkkvmgfghrvykngdsrvptmksaldamikhydrpemlgl
    yngleaameeakqikpnldypagptynlmgfdtemftplfiaaritgwtahimeqvadna
    lirplseyngpeqrqvp