PDB entry 1a58

View 1a58 on RCSB PDB site
Description: cyclophilin from brugia malayi
Deposited on 1998-02-20, released 1998-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1a58__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a58_ (-)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv