PDB entry 1a57

View 1a57 on RCSB PDB site
Description: the three-dimensional structure of a helix-less variant of intestinal fatty acid binding protein, nmr, 20 structures
Class: fatty acid-binding
Keywords: fatty acid-binding, lipid transport, beta-clam, lipocalins
Deposited on 1998-02-20, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intestinal fatty acid-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02693 (0-115)
      • engineered (14)
    Domains in SCOPe 2.07: d1a57a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a57A (A:)
    afdgtwkvdrnenysgahdnlkltitqegnkftvkessnfrnidvvfelgvdfaysladg
    teltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytyegveakrifkke