PDB entry 1a57

View 1a57 on RCSB PDB site
Description: the three-dimensional structure of a helix-less variant of intestinal fatty acid binding protein, nmr, 20 structures
Class: fatty acid-binding
Keywords: fatty acid-binding, lipid transport, beta-clam, lipocalins
Deposited on 1998-02-20, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: intestinal fatty acid-binding protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02693 (0-115)
    • engineered (14)
  Domains in SCOPe 2.08: d1a57a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a57A (A:)
  afdgtwkvdrnenysgahdnlkltitqegnkftvkessnfrnidvvfelgvdfaysladg
  teltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytyegveakrifkke