PDB entry 1a54

View 1a54 on RCSB PDB site
Description: phosphate-binding protein mutant a197c labelled with a coumarin fluorophore and bound to dihydrogenphosphate ion
Class: phosphotransferase
Keywords: phosphotransferase, transport, coumarin, fluorophore
Deposited on 1998-02-19, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate-binding protein
    Species: Escherichia coli [TaxId:562]
    Gene: PHO-S
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06128 (0-320)
      • engineered (196)
    Domains in SCOPe 2.08: d1a54a_
  • Heterogens: 2HP, MDC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a54A (A:)
    easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
    deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
    pglklpsqniavvrradgsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
    aafvqrlpgaigyveycyakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
    ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
    veqvraawktnikdssgkply