PDB entry 1a53

View 1a53 on RCSB PDB site
Description: complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution
Deposited on 1998-02-19, released 1999-03-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1a53__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a53_ (-)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
    verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
    aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
    rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
    kikefil