PDB entry 1a52

View 1a52 on RCSB PDB site
Description: estrogen receptor alpha ligand-binding domain complexed to estradiol
Deposited on 1998-02-19, released 1998-09-16
The last revision prior to the SCOP 1.55 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a52a_
  • Chain 'B':
    Domains in SCOP 1.55: d1a52b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a52A (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a52B (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvplydllleml