PDB entry 1a4x

View 1a4x on RCSB PDB site
Description: pyrr, the bacillus subtilis pyrimidine biosynthetic operon repressor, hexameric form
Deposited on 1998-02-08, released 1998-08-05
The last revision prior to the SCOP 1.61 freeze date was dated 1998-08-05, with a file datestamp of 1998-08-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1a4xa_
  • Chain 'B':
    Domains in SCOP 1.61: d1a4xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a4xA (A:)
    kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
    vgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdalvd
    vgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4xA (A:)
    kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
    vgeiditlyreplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgrpssiqla
    vlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a4xB (B:)
    kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
    vgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdalvd
    vgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4xB (B:)
    kavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnpvt
    vgeiditlydeplvkgadipvditdqkvilvddvlytgrtvragmdalvdvgrpssiqla
    vlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiyen