PDB entry 1a4v

View 1a4v on RCSB PDB site
Description: alpha-lactalbumin
Class: lactose synthase
Keywords: lactose synthase, calcium binding, alpha-lactalbumin
Deposited on 1998-02-05, released 1999-04-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-lactalbumin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00709 (0-122)
  Domains in SCOPe 2.04: d1a4va_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1a4vA (A:)
  kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
  ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
  ekl