PDB entry 1a4u

View 1a4u on RCSB PDB site
Description: alcohol dehydrogenase from drosophila lebanonensis
Class: oxidoreductase
Keywords: oxidoreductase, detoxification, metabolism, alcohol dehydrogenase, drosophila lebanonensis, short-chain dehydrogenases/reductases
Deposited on 1998-02-05, released 1999-02-16
The last revision prior to the SCOP 1.73 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Drosophila lebanonensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1a4ua_
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Drosophila lebanonensis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1a4ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4uA (A:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4uB (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi