PDB entry 1a4s

View 1a4s on RCSB PDB site
Description: betaine aldehyde dehydrogenase from cod liver
Deposited on 1998-02-03, released 1998-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a4sa_
  • Chain 'B':
    Domains in SCOP 1.55: d1a4sb_
  • Chain 'C':
    Domains in SCOP 1.55: d1a4sc_
  • Chain 'D':
    Domains in SCOP 1.55: d1a4sd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4sA (A:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4sB (B:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4sC (C:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4sD (D:)
    aqlvdsmpsastgsvvvtddlnywggrrikskdgattepvfepatgrvlcqmvpcgaeev
    dqavqsaqaaylkwskmagiersrvmleaariirerrdniaklevinngktiteaeydid
    aawqcieyyaglaptlsgqhiqlpggafaytrreplgvcagilawnypfmiaawkcapal
    acgnavvfkpspmtpvtgvilaeifheagvpvglvnvvqggaetgsllchhpnvakvsft
    gsvptgkkvmemsaktvkhvtlelggkspllifkdcelenavrgalmanfltqgqvctng
    trvfvqreimpqfleevvkrtkaivvgdplltetrmggliskpqldkvlgfvaqakkega
    rvlcggepltpsdpklkngyfmspcvldncrddmtcvkeeifgpvmsvlpfdteeevlqr
    annttfglasgvftrdisrahrvaanleagtcyintysispvevpfggykmsgfgrengq
    atvdyysqlktvivemgdvdslf