PDB entry 1a4r

View 1a4r on RCSB PDB site
Description: g12v mutant of human placental cdc42 gtpase in the GDP form
Class: hydrolase
Keywords: hydrolase, gtpase, signal transduction
Deposited on 1998-02-02, released 1999-03-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: g25k GTP-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953
      • engineered (11)
    Domains in SCOPe 2.01: d1a4ra_
  • Chain 'B':
    Compound: g25k GTP-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (0-End)
      • engineered (11)
    Domains in SCOPe 2.01: d1a4rb_
  • Heterogens: MG, GDP, GNH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a4rA (A:)
    mqtikcvvvgdvavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4rA (A:)
    mqtikcvvvgdvavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a4rB (B:)
    mqtikcvvvgdvavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4rB (B:)
    mqtikcvvvgdvavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvl