PDB entry 1a4q

View 1a4q on RCSB PDB site
Description: influenza virus b/beijing/1/87 neuraminidase complexed with dihydropyran-phenethyl-propyl-carboxamide
Deposited on 1998-01-30, released 1999-03-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1a4qa_
  • Chain 'B':
    Domains in SCOP 1.55: d1a4qb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4qA (A:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4qB (B:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal