PDB entry 1a4p

View 1a4p on RCSB PDB site
Description: p11 (s100a10), ligand of annexin II
Class: calcium/phospholipid binding protein
Keywords: S100 FAMILY, EF-HAND PROTEIN, LIGAND OF ANNEXIN II, CALCIUM/PHOSPHOLIPID BINDING PROTEIN, CALCIUM-PHOSPHOLIPID BINDING PROTEIN complex
Deposited on 1998-01-30, released 1998-05-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100a10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1a4pa_
  • Chain 'B':
    Compound: s100a10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1a4pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a4pA (A:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmkqkgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4pA (A:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a4pB (B:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmkqkgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4pB (B:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmk