PDB entry 1a4l

View 1a4l on RCSB PDB site
Description: ada structure complexed with deoxycoformycin at ph 7.0
Deposited on 1998-01-31, released 1998-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.185
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1a4la_
  • Chain 'B':
    Domains in SCOP 1.57: d1a4lb_
  • Chain 'C':
    Domains in SCOP 1.57: d1a4lc_
  • Chain 'D':
    Domains in SCOP 1.57: d1a4ld_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lA (A:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lB (B:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lC (C:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lD (D:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq