PDB entry 1a4l

View 1a4l on RCSB PDB site
Description: ada structure complexed with deoxycoformycin at ph 7.0
Class: hydrolase
Keywords: hydrolase, adenosine deaminase, pentostatin, deoxycoformycin
Deposited on 1998-01-31, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.185
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4la_
  • Chain 'B':
    Compound: adenosine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4lb_
  • Chain 'C':
    Compound: adenosine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4lc_
  • Chain 'D':
    Compound: adenosine deaminase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ld_
  • Heterogens: ZN, DCF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lA (A:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lB (B:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lC (C:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4lD (D:)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq