PDB entry 1a4k

View 1a4k on RCSB PDB site
Description: diels alder catalytic antibody with transition state analogue
Deposited on 1998-01-30, released 1998-05-13
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4kA (A:)
    elvmtqtplslpvslgdqasiscrssqsllhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqvthvpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4kB (B:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4kH (H:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4kL (L:)
    elvmtqtplslpvslgdqasiscrssqsllhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqvthvpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg