PDB entry 1a4j

View 1a4j on RCSB PDB site
Description: diels alder catalytic antibody germline precursor
Class: immunoglobulin
Keywords: immunoglobulin, antibody, catalytic antibody, diels alder, germline
Deposited on 1998-01-30, released 1998-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin, diels alder catalytic antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ja1, d1a4ja2
  • Chain 'B':
    Compound: immunoglobulin, diels alder catalytic antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1A4J (0-End)
    Domains in SCOPe 2.07: d1a4jb1, d1a4jb2
  • Chain 'H':
    Compound: immunoglobulin, diels alder catalytic antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1A4J (0-End)
    Domains in SCOPe 2.07: d1a4jh1, d1a4jh2
  • Chain 'L':
    Compound: immunoglobulin, diels alder catalytic antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4jl1, d1a4jl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4jA (A:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a4jB (B:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4jB (B:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1a4jH (H:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4jH (H:)
    qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4jL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrg