PDB entry 1a4i

View 1a4i on RCSB PDB site
Description: human tetrahydrofolate dehydrogenase / cyclohydrolase
Deposited on 1998-01-30, released 1999-02-09
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.199
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a4iA (A:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyv
    pddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4iA (A:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyk
    vvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4iB (B:)
    apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
    eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
    kdvdgltsinagrlargdlndcfipctpkgcleliketgvpiagrhavvvgrskivgapm
    hdlllwnnatvttchsktahldeevnkgdilvvatgqpemvkgewikpgaividcginyv
    pddkkpngrkvvgdvaydeakerasfitpvpggvgpmtvamlmqstvesakrfle