PDB entry 1a4g

View 1a4g on RCSB PDB site
Description: influenza virus b/beijing/1/87 neuraminidase complexed with zanamivir
Class: hydrolase
Keywords: hydrolase, glycosidase, glycosylated protein
Deposited on 1998-01-29, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza B virus (STRAIN B/BEIJING/1/87) [TaxId:11525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ga_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza B virus (STRAIN B/BEIJING/1/87) [TaxId:11525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4gb_
  • Heterogens: NAG, CA, ZMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4gA (A:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4gB (B:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal