PDB entry 1a4e

View 1a4e on RCSB PDB site
Description: catalase a from saccharomyces cerevisiae
Class: oxidoreductase
Keywords: oxidoreductase, catalase, peroxidase
Deposited on 1998-01-29, released 1999-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.154
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ea_
  • Chain 'B':
    Compound: catalase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4eb_
  • Chain 'C':
    Compound: catalase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ec_
  • Chain 'D':
    Compound: catalase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ed_
  • Heterogens: AZI, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4eA (A:)
    dvredrvvtnstgnpinepfvtqrigehgplllqdynlidslahfnrenipqrnphahgs
    gafgyfevtdditdicgsamfskigkrtkcltrfstvggdkgsadtvrdprgfatkfyte
    egnldwvynntpvffirdpskfphfihtqkrnpqtnlrdadmfwdflttpenqvaihqvm
    ilfsdrgtpanyrsmhgysghtykwsnkngdwhyvqvhiktdqgiknltieeatkiagsn
    pdycqqdlfeaiqngnypswtvyiqtmterdakklpfsvfdltkvwpqgqfplrrvgkiv
    lnenplnffaqveqaafapsttvpyqeasadpvlqarlfsyadahryrlgpnfhqipvnc
    pyaskffnpairdgpmnvngnfgseptylandksytyiqqdrpiqqhqevwngpaipyhw
    atspgdvdfvqarnlyrvlgkqpgqqknlaynigihvegacpqiqqrvydmfarvdkgls
    eaikkvae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4eB (B:)
    dvredrvvtnstgnpinepfvtqrigehgplllqdynlidslahfnrenipqrnphahgs
    gafgyfevtdditdicgsamfskigkrtkcltrfstvggdkgsadtvrdprgfatkfyte
    egnldwvynntpvffirdpskfphfihtqkrnpqtnlrdadmfwdflttpenqvaihqvm
    ilfsdrgtpanyrsmhgysghtykwsnkngdwhyvqvhiktdqgiknltieeatkiagsn
    pdycqqdlfeaiqngnypswtvyiqtmterdakklpfsvfdltkvwpqgqfplrrvgkiv
    lnenplnffaqveqaafapsttvpyqeasadpvlqarlfsyadahryrlgpnfhqipvnc
    pyaskffnpairdgpmnvngnfgseptylandksytyiqqdrpiqqhqevwngpaipyhw
    atspgdvdfvqarnlyrvlgkqpgqqknlaynigihvegacpqiqqrvydmfarvdkgls
    eaikkvae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4eC (C:)
    dvredrvvtnstgnpinepfvtqrigehgplllqdynlidslahfnrenipqrnphahgs
    gafgyfevtdditdicgsamfskigkrtkcltrfstvggdkgsadtvrdprgfatkfyte
    egnldwvynntpvffirdpskfphfihtqkrnpqtnlrdadmfwdflttpenqvaihqvm
    ilfsdrgtpanyrsmhgysghtykwsnkngdwhyvqvhiktdqgiknltieeatkiagsn
    pdycqqdlfeaiqngnypswtvyiqtmterdakklpfsvfdltkvwpqgqfplrrvgkiv
    lnenplnffaqveqaafapsttvpyqeasadpvlqarlfsyadahryrlgpnfhqipvnc
    pyaskffnpairdgpmnvngnfgseptylandksytyiqqdrpiqqhqevwngpaipyhw
    atspgdvdfvqarnlyrvlgkqpgqqknlaynigihvegacpqiqqrvydmfarvdkgls
    eaikkvae
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4eD (D:)
    dvredrvvtnstgnpinepfvtqrigehgplllqdynlidslahfnrenipqrnphahgs
    gafgyfevtdditdicgsamfskigkrtkcltrfstvggdkgsadtvrdprgfatkfyte
    egnldwvynntpvffirdpskfphfihtqkrnpqtnlrdadmfwdflttpenqvaihqvm
    ilfsdrgtpanyrsmhgysghtykwsnkngdwhyvqvhiktdqgiknltieeatkiagsn
    pdycqqdlfeaiqngnypswtvyiqtmterdakklpfsvfdltkvwpqgqfplrrvgkiv
    lnenplnffaqveqaafapsttvpyqeasadpvlqarlfsyadahryrlgpnfhqipvnc
    pyaskffnpairdgpmnvngnfgseptylandksytyiqqdrpiqqhqevwngpaipyhw
    atspgdvdfvqarnlyrvlgkqpgqqknlaynigihvegacpqiqqrvydmfarvdkgls
    eaikkvae