PDB entry 1a4c

View 1a4c on RCSB PDB site
Description: azurin mutant with met 121 replaced by his, ph 3.5 crystal form, data collected at-180 degrees celsius
Class: electron transport
Keywords: electron transport, cuproprotein
Deposited on 1998-01-28, released 1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (15)
      • see remark 999 (41)
      • conflict (56)
      • engineered (120)
    Domains in SCOPe 2.08: d1a4ca_
  • Chain 'B':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (15)
      • see remark 999 (41)
      • conflict (56)
      • engineered (120)
    Domains in SCOPe 2.08: d1a4cb_
  • Chain 'C':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (15)
      • see remark 999 (41)
      • conflict (56)
      • engineered (120)
    Domains in SCOPe 2.08: d1a4cc_
  • Chain 'D':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (15)
      • see remark 999 (41)
      • conflict (56)
      • engineered (120)
    Domains in SCOPe 2.08: d1a4cd_
  • Heterogens: CU, SO4, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4cA (A:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4cB (B:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4cC (C:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4cD (D:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn